PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G146600.1.p
Common NameLOC101769398, SETIT_019945mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 402aa    MW: 43215.2 Da    PI: 8.5798
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G146600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.74e-31233288156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         kpr++W+peLH+rF++a++qLGGs++AtP +i+elmkv+gLt+++vkSHLQkYRl+
  Seita.1G146600.1.p 233 KPRRCWAPELHRRFLQALQQLGGSHVATPTQIRELMKVDGLTNDEVKSHLQKYRLH 288
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.282230290IPR017930Myb domain
SuperFamilySSF466897.01E-17231291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27231291IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-26233288IPR006447Myb domain, plants
PfamPF002494.1E-6235286IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MDPPLPSPQY AHRRRCSEYL LALEEERRKI QVFKRELPLC LQLVTQTIEG MKSQMHGVGS  60
EGTVSDHGPV LEEFMPLKPS LSLSSDEHES ADDAAATNDV GKKEKAAETH GRQSPPTEAN  120
KAMPDWLQSV QLWSQEPQQQ PSSPRKELLC KPVALNTRKA GDAFQPFVKE KRAEMPASPT  180
TAAASSAVVG DSCDKVATDT SEKHSDKEMN KDAKDMGKYS KDKEGQSQAP NRKPRRCWAP  240
ELHRRFLQAL QQLGGSHVAT PTQIRELMKV DGLTNDEVKS HLQKYRLHTR RPNSTTVVQS  300
TSTSAAQPAP QFVVVGGIWV PPAEYATAAA AASAAAAAQS QVQLAGDASG TANTVYAPVA  360
TLPSGTRQGQ RQSSRCSGGR RSGDASSDSP AVSSSSHTTS A*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0355361e-76BT035536.2 Zea mays full-length cDNA clone ZM_BFb0068J14 mRNA, complete cds.
GenBankKJ7268381e-76KJ726838.1 Zea mays clone pUT3378 G2-like transcription factor (GLK5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954868.20.0PREDICTED: uncharacterized protein LOC101769398
TrEMBLK3Z0840.0K3Z084_SETIT; Uncharacterized protein
STRINGSi019945m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.18e-63G2-like family protein